Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d4ocnf1: 4ocn F:7-122 [237869] Other proteins in same PDB: d4ocna_, d4ocnb_, d4ocnc2, d4ocnc3, d4ocnd_, d4ocne_, d4ocnf2, d4ocnf3 automated match to d4ocnc_ |
PDB Entry: 4ocn (more details), 2.25 Å
SCOPe Domain Sequences for d4ocnf1:
Sequence, based on SEQRES records: (download)
>d4ocnf1 b.1.1.1 (F:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyyadsvk grftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
>d4ocnf1 b.1.1.1 (F:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvpaggslrlscvdsgrfsstvmawfrqapgkerefvatirwsggntyyadsvkg rftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
Timeline for d4ocnf1: