Lineage for d4ocnb_ (4ocn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918897Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2918898Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2918953Protein automated matches [267675] (2 species)
    not a true protein
  7. 2918954Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346341] (4 PDB entries)
  8. 2918959Domain d4ocnb_: 4ocn B: [344010]
    Other proteins in same PDB: d4ocna_, d4ocnc1, d4ocnc2, d4ocnc3, d4ocnd_, d4ocnf1, d4ocnf2, d4ocnf3
    automated match to d5w83b_

Details for d4ocnb_

PDB Entry: 4ocn (more details), 2.25 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii
PDB Compounds: (B:) 26s proteasome regulatory subunit rpn11

SCOPe Domain Sequences for d4ocnb_:

Sequence, based on SEQRES records: (download)

>d4ocnb_ c.97.3.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsvea
vddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvd
piqsvkgkvvidafrlidtgalinnleprqttsntgllnkaniqalihglnrhyyslnid
yhktaketkmlmnlh

Sequence, based on observed residues (ATOM records): (download)

>d4ocnb_ c.97.3.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgvddvfqa
kmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdpiqsvkg
kvvidafrlidtgalinnllnrhyyslnidyhktaketkmlmnlh

SCOPe Domain Coordinates for d4ocnb_:

Click to download the PDB-style file with coordinates for d4ocnb_.
(The format of our PDB-style files is described here.)

Timeline for d4ocnb_: