| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) ![]() |
| Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
| Protein Proteasome regulatory subunit Rpn8 [346089] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries) |
| Domain d4ocnd_: 4ocn D: [263276] Other proteins in same PDB: d4ocnb_, d4ocnc1, d4ocnc2, d4ocnc3, d4ocne_, d4ocnf1, d4ocnf2, d4ocnf3 automated match to d2o95a_ |
PDB Entry: 4ocn (more details), 2.25 Å
SCOPe Domain Sequences for d4ocnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ocnd_ c.97.3.1 (D:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllr
Timeline for d4ocnd_: