SCOPe 2.07: Domain d4ocnf_: 4ocn F:

Lineage for d4ocnf_ (4ocn F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d4ocnf_: 4ocn F: [237869]
   Other proteins in same PDB: d4ocna_, d4ocnb_, d4ocnd_, d4ocne_
   automated match to d4ocnc_

Details for d4ocnf_

PDB Entry: 4ocn, 2.25 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii

PDB Compounds: (F:) Nb1

SCOPe Domain Sequences for d4ocnf_:

Sequence, based on SEQRES records:

>d4ocnf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhh

Sequence, based on observed residues (ATOM records):

>d4ocnf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrfsstvmawfrqapgkerefvatirwsggntyyad
svkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvss
hhh

Timeline for d4ocnf_:

• d4ocnf_ first appeared in SCOPe 2.03
  
• d4ocnf_ appears in SCOPe 2.06
  
• d4ocnf_ appears in the current release, SCOPe 2.08, called d4ocnf1