Lineage for d4ocnf_ (4ocn F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356131Domain d4ocnf_: 4ocn F: [237869]
    Other proteins in same PDB: d4ocna_, d4ocnb_, d4ocnd_, d4ocne_
    automated match to d4ocnc_

Details for d4ocnf_

PDB Entry: 4ocn (more details), 2.25 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii
PDB Compounds: (F:) Nb1

SCOPe Domain Sequences for d4ocnf_:

Sequence, based on SEQRES records: (download)

>d4ocnf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhh

Sequence, based on observed residues (ATOM records): (download)

>d4ocnf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrfsstvmawfrqapgkerefvatirwsggntyyad
svkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvss
hhh

SCOPe Domain Coordinates for d4ocnf_:

Click to download the PDB-style file with coordinates for d4ocnf_.
(The format of our PDB-style files is described here.)

Timeline for d4ocnf_: