Lineage for d4ocnc1 (4ocn C:7-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743991Domain d4ocnc1: 4ocn C:7-122 [236488]
    Other proteins in same PDB: d4ocna_, d4ocnb_, d4ocnc2, d4ocnc3, d4ocnd_, d4ocne_, d4ocnf2, d4ocnf3
    automated match to d3ogog_

Details for d4ocnc1

PDB Entry: 4ocn (more details), 2.25 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii
PDB Compounds: (C:) Nb1

SCOPe Domain Sequences for d4ocnc1:

Sequence, based on SEQRES records: (download)

>d4ocnc1 b.1.1.1 (C:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyyadsvk
grftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d4ocnc1 b.1.1.1 (C:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvpaggslrlscvdsgrstvmawfrqapgkerefvatirwsggntyyadsvkgrf
tisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs

SCOPe Domain Coordinates for d4ocnc1:

Click to download the PDB-style file with coordinates for d4ocnc1.
(The format of our PDB-style files is described here.)

Timeline for d4ocnc1: