Lineage for d1bvp52 (1bvp 5:121-254)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12156Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)
  4. 12157Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families) (S)
  5. 12158Family b.19.1.1: Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49819] (1 protein)
  6. 12159Protein Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)
  7. 12164Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)
  8. 12169Domain d1bvp52: 1bvp 5:121-254 [23779]
    Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61

Details for d1bvp52

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp52:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp52 b.19.1.1 (5:121-254) Virus coat protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd

SCOP Domain Coordinates for d1bvp52:

Click to download the PDB-style file with coordinates for d1bvp52.
(The format of our PDB-style files is described here.)

Timeline for d1bvp52: