SCOP 1.55: Domain d1bvp42: 1bvp 4:121-254

Lineage for d1bvp42 (1bvp 4:121-254)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)

4. Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families)

5. Family b.19.1.1: Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49819] (1 protein)

6. Protein Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)

7. Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)

8. Domain d1bvp42: 1bvp 4:121-254 [23778]
   Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61

Details for d1bvp42

PDB Entry: 1bvp, 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp42:

Sequence; same for both SEQRES and ATOM records:

>d1bvp42 b.19.1.1 (4:121-254) Virus coat protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd

Timeline for d1bvp42:

• d1bvp42 appears in SCOP 1.57
  
• d1bvp42 appears in the current release, SCOPe 2.08