SCOP 1.55: Domain d1bvp51: 1bvp 5:1-120,5:255-349

Lineage for d1bvp51 (1bvp 5:1-120,5:255-349)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.115: Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48344] (1 superfamily)

4. Superfamily a.115.1: Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48345] (1 family)

5. Family a.115.1.1: Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48346] (1 protein)

6. Protein Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48347] (1 species)

7. Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)

8. Domain d1bvp51: 1bvp 5:1-120,5:255-349 [19083]
   Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp51

PDB Entry: 1bvp, 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp51:

Sequence; same for both SEQRES and ATOM records:

>d1bvp51 a.115.1.1 (5:1-120,5:255-349) Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

Timeline for d1bvp51:

• d1bvp51 appears in SCOP 1.57
  
• d1bvp51 appears in the current release, SCOPe 2.08