Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries) |
Domain d4c5db1: 4c5d B:1-198 [236516] Other proteins in same PDB: d4c5da2, d4c5db2 automated match to d3fdma_ complexed with edo, so4, x0r |
PDB Entry: 4c5d (more details), 2.3 Å
SCOPe Domain Sequences for d4c5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c5db1 f.1.4.1 (B:1-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelygnn
Timeline for d4c5db1: