SCOPe 2.08: Domain d4c5da1: 4c5d A:1-196

Lineage for d4c5da1 (4c5d A:1-196)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d4c5da1: 4c5d A:1-196 [236515]
   Other proteins in same PDB: d4c5da2, d4c5db2
   automated match to d3fdma_
   complexed with edo, so4, x0r

Details for d4c5da1

PDB Entry: 4c5d, 2.3 Å

PDB Description: Crystal structure of Bcl-xL in complex with benzoylurea compound (42)

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4c5da1:

Sequence; same for both SEQRES and ATOM records:

>d4c5da1 f.1.4.1 (A:1-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

Timeline for d4c5da1:

• d4c5da1 first appeared in SCOPe 2.03, called d4c5da_
  
• d4c5da1 appears in SCOPe 2.07