![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein automated matches [233395] (2 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [233396] (3 PDB entries) |
![]() | Domain d3r60a1: 3r60 A:4-62 [233397] Other proteins in same PDB: d3r60a2, d3r60b2 automated match to d1on1a1 complexed with epe, fe2, pgo |
PDB Entry: 3r60 (more details), 1.8 Å
SCOPe Domain Sequences for d3r60a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r60a1 a.4.5.24 (A:4-62) automated matches {Bacillus subtilis [TaxId: 1423]} psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
Timeline for d3r60a1: