SCOPe 2.08: Domain d3r60b2: 3r60 B:63-139

Lineage for d3r60b2 (3r60 B:63-139)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein automated matches [233398] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries)

8. Domain d3r60b2: 3r60 B:63-139 [233402]
   Other proteins in same PDB: d3r60a1, d3r60b1
   automated match to d1on2a2
   complexed with epe, fe2, pgo

Details for d3r60b2

PDB Entry: 3r60, 1.8 Å

PDB Description: Structure of the MntR Fe2+ Complex

PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d3r60b2:

Sequence; same for both SEQRES and ATOM records:

>d3r60b2 a.76.1.1 (B:63-139) automated matches {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkkteh

Timeline for d3r60b2:

• d3r60b2 first appeared in SCOPe 2.03
  
• d3r60b2 appears in SCOPe 2.07