SCOPe 2.08: Domain d3nteb2: 3nte B:148-221

Lineage for d3nteb2 (3nte B:148-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d3nteb2: 3nte B:148-221 [233044]
   Other proteins in same PDB: d3ntea1, d3nteb1
   automated match to d1e6jp1
   complexed with fe, i3m, iod, na

Details for d3nteb2

PDB Entry: 3nte, 1.95 Å

PDB Description: crystal structure of the wild-type full-length hiv-1 capsid protein

PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3nteb2:

Sequence; same for both SEQRES and ATOM records:

>d3nteb2 a.28.3.0 (B:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
aatleemmtacqgv

Timeline for d3nteb2:

• d3nteb2 first appeared in SCOPe 2.03
  
• d3nteb2 appears in SCOPe 2.07