Lineage for d3nteb1 (3nte B:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000764Protein automated matches [190369] (6 species)
    not a true protein
  7. 2000765Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)
  8. 2000773Domain d3nteb1: 3nte B:1-147 [233042]
    Other proteins in same PDB: d3ntea2, d3nteb2
    automated match to d1e6jp2
    complexed with fe, i3m, iod, na

Details for d3nteb1

PDB Entry: 3nte (more details), 1.95 Å

PDB Description: crystal structure of the wild-type full-length hiv-1 capsid protein
PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3nteb1:

Sequence, based on SEQRES records: (download)

>d3nteb1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtn
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d3nteb1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrvhpvhagpmreprgsdiagttstlqeqigwmtnnppip
vgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d3nteb1:

Click to download the PDB-style file with coordinates for d3nteb1.
(The format of our PDB-style files is described here.)

Timeline for d3nteb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nteb2