SCOPe 2.08: Domain d3nteb1: 3nte B:1-147

Lineage for d3nteb1 (3nte B:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (8 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)

8. Domain d3nteb1: 3nte B:1-147 [233042]
   Other proteins in same PDB: d3ntea2, d3nteb2
   automated match to d1e6jp2
   complexed with fe, i3m, iod, na

Details for d3nteb1

PDB Entry: 3nte, 1.95 Å

PDB Description: crystal structure of the wild-type full-length hiv-1 capsid protein

PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3nteb1:

Sequence, based on SEQRES records:

>d3nteb1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtn
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d3nteb1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrvhpvhagpmreprgsdiagttstlqeqigwmtnnppip
vgeiykrwiilglnkivrmysp

Timeline for d3nteb1:

• d3nteb1 first appeared in SCOPe 2.03
  
• d3nteb1 appears in SCOPe 2.07