PDB entry 3nte

View 3nte on RCSB PDB site
Description: Crystal Structure of the Wild-type Full-Length HIV-1 Capsid Protein
Class: viral protein
Keywords: wild type viral protein, VIRAL PROTEIN
Deposited on 2010-07-03, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ntea1, d3ntea2
  • Chain 'B':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nteb1, d3nteb2
  • Heterogens: IOD, I3M, FE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nteA (A:)
    pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtn
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nteB (B:)
    pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtn
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpaatleemmtacqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nteB (B:)
    pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrvhpvhagpmreprgsdiagttstlqeqigwmtnnppip
    vgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwm
    tetllvqnanpdcktilkalgpaatleemmtacqgv