SCOPe 2.08: Domain d2pzfa1: 2pzf A:387-646

Lineage for d2pzfa1 (2pzf A:387-646)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
   Uniprot P13569 389-671

8. Domain d2pzfa1: 2pzf A:387-646 [231180]
   Other proteins in same PDB: d2pzfa2
   automated match to d2pzfb_
   complexed with atp, mg

Details for d2pzfa1

PDB Entry: 2pzf, 2 Å

PDB Description: minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508

PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d2pzfa1:

Sequence, based on SEQRES records:

>d2pzfa1 c.37.1.12 (A:387-646) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ltttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgeleps
egkikhsgrisfcsqfswimpgtikeniigvsydeyryrsvikacqleediskfaekdni
vlgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmankt
rilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg

Sequence, based on observed residues (ATOM records):

>d2pzfa1 c.37.1.12 (A:387-646) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ltttevvmenvtafwggtpvlkdinfkiergqllavagstgagktsllmmimgelepseg
kikhsgrisfcsqfswimpgtikeniigvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnldfssklmg

Timeline for d2pzfa1:

• d2pzfa1 first appeared in SCOPe 2.03, called d2pzfa_
  
• d2pzfa1 appears in SCOPe 2.07