Lineage for d2pzfb_ (2pzf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2112801Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2112802Species Human (Homo sapiens) [TaxId:9606] [117543] (9 PDB entries)
    Uniprot P13569 389-671
  8. 2112808Domain d2pzfb_: 2pzf B: [205697]
    Other proteins in same PDB: d2pzfa2
    automated match to d1l2ta_
    complexed with atp, mg

Details for d2pzfb_

PDB Entry: 2pzf (more details), 2 Å

PDB Description: minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508
PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d2pzfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzfb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepse
gkikhsgrisfcsqfswimpgtikeniigvsydeyryrsvikacqleediskfaekdniv
lgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktr
ilvtskmehlkkadkililhegssyfygtfselqnl

SCOPe Domain Coordinates for d2pzfb_:

Click to download the PDB-style file with coordinates for d2pzfb_.
(The format of our PDB-style files is described here.)

Timeline for d2pzfb_: