Lineage for d2be7d2 (2be7 D:100-151)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036845Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 3036846Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 3036847Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 3036985Species Moritella profunda [TaxId:111291] [230528] (1 PDB entry)
  8. 3036986Domain d2be7d2: 2be7 D:100-151 [230529]
    Other proteins in same PDB: d2be7a1, d2be7a2, d2be7b1, d2be7b2, d2be7c1, d2be7c2, d2be7d1, d2be7e1, d2be7f1
    automated match to d2atcb2
    complexed with so4, zn

Details for d2be7d2

PDB Entry: 2be7 (more details), 2.85 Å

PDB Description: crystal structure of the unliganded (t-state) aspartate transcarbamoylase of the psychrophilic bacterium moritella profunda
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be7d2 g.41.7.1 (D:100-151) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Moritella profunda [TaxId: 111291]}
nevenvfpcpnsncithgepvtssfsikktkgniglkckycektfskdivte

SCOPe Domain Coordinates for d2be7d2:

Click to download the PDB-style file with coordinates for d2be7d2.
(The format of our PDB-style files is described here.)

Timeline for d2be7d2: