![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) ![]() automatically mapped to Pfam PF02748 |
![]() | Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
![]() | Species Moritella profunda [TaxId:111291] [230528] (1 PDB entry) |
![]() | Domain d2be7d2: 2be7 D:100-151 [230529] Other proteins in same PDB: d2be7a1, d2be7a2, d2be7b1, d2be7b2, d2be7c1, d2be7c2, d2be7d1, d2be7e1, d2be7f1 automated match to d2atcb2 complexed with so4, zn |
PDB Entry: 2be7 (more details), 2.85 Å
SCOPe Domain Sequences for d2be7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be7d2 g.41.7.1 (D:100-151) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Moritella profunda [TaxId: 111291]} nevenvfpcpnsncithgepvtssfsikktkgniglkckycektfskdivte
Timeline for d2be7d2: