SCOPe 2.08: Domain d2be7c2: 2be7 C:151-310

Lineage for d2be7c2 (2be7 C:151-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Moritella profunda [TaxId:111291] [225163] (1 PDB entry)

8. Domain d2be7c2: 2be7 C:151-310 [203591]
   Other proteins in same PDB: d2be7d1, d2be7d2, d2be7e1, d2be7e2, d2be7f1, d2be7f2
   automated match to d1ekxa2
   complexed with so4, zn

Details for d2be7c2

PDB Entry: 2be7, 2.85 Å

PDB Description: crystal structure of the unliganded (t-state) aspartate transcarbamoylase of the psychrophilic bacterium moritella profunda

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2be7c2:

Sequence; same for both SEQRES and ATOM records:

>d2be7c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Moritella profunda [TaxId: 111291]}
rldnlniafvgdlkygrtvhslaqalakfdgckfhfiapdalampeyicdeldeqnisya
tyasieevvpeidvlymtrvqkerfdeteyqhmkagfilsasslvhakpnlkvlhplprv
deiatdvdktpyayyfqqaengvyareallalvlnetige

Timeline for d2be7c2:

• d2be7c2 first appeared in SCOPe 2.03
  
• d2be7c2 appears in SCOPe 2.07