![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
![]() | Species Moritella profunda [TaxId:111291] [225163] (1 PDB entry) |
![]() | Domain d2be7c1: 2be7 C:2-150 [203590] Other proteins in same PDB: d2be7d1, d2be7d2, d2be7e1, d2be7e2, d2be7f1, d2be7f2 automated match to d1ekxa1 complexed with so4, zn |
PDB Entry: 2be7 (more details), 2.85 Å
SCOPe Domain Sequences for d2be7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be7c1 c.78.1.1 (C:2-150) Aspartate carbamoyltransferase catalytic subunit {Moritella profunda [TaxId: 111291]} anplfrkhivsindisrnelelivktaaklkeqpqpellknkviascffeastrtrlsfe taiqrlggsvigfdnagntslakkgetladsisvissyadafvmrhpqegaarlasefsn vpvinggdgsnqhptqtlldlfsiyetqg
Timeline for d2be7c1: