Lineage for d2be7b2 (2be7 B:151-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906435Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2906730Species Moritella profunda [TaxId:111291] [225163] (1 PDB entry)
  8. 2906734Domain d2be7b2: 2be7 B:151-310 [203589]
    Other proteins in same PDB: d2be7d1, d2be7d2, d2be7e1, d2be7e2, d2be7f1, d2be7f2
    automated match to d1ekxa2
    complexed with so4, zn

Details for d2be7b2

PDB Entry: 2be7 (more details), 2.85 Å

PDB Description: crystal structure of the unliganded (t-state) aspartate transcarbamoylase of the psychrophilic bacterium moritella profunda
PDB Compounds: (B:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2be7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be7b2 c.78.1.1 (B:151-310) Aspartate carbamoyltransferase catalytic subunit {Moritella profunda [TaxId: 111291]}
rldnlniafvgdlkygrtvhslaqalakfdgckfhfiapdalampeyicdeldeqnisya
tyasieevvpeidvlymtrvqkerfdeteyqhmkagfilsasslvhakpnlkvlhplprv
deiatdvdktpyayyfqqaengvyareallalvlnetige

SCOPe Domain Coordinates for d2be7b2:

Click to download the PDB-style file with coordinates for d2be7b2.
(The format of our PDB-style files is described here.)

Timeline for d2be7b2: