SCOPe 2.08: Domain d4mgha2: 4mgh A:153-220

Lineage for d4mgha2 (4mgh A:153-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family)

5. Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein)

6. Protein FGAM synthase PurL, linker domain [109738] (3 species)

7. Species Salmonella typhimurium [TaxId:99287] [229688] (1 PDB entry)

8. Domain d4mgha2: 4mgh A:153-220 [229689]
   Other proteins in same PDB: d4mgha1, d4mgha3, d4mgha4, d4mgha5, d4mgha6, d4mgha7, d4mgha8
   automated match to d3ujna2
   complexed with act, adp, mg, mn, so4, xe

Details for d4mgha2

PDB Entry: 4mgh, 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha2:

Sequence; same for both SEQRES and ATOM records:

>d4mgha2 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella typhimurium [TaxId: 99287]}
hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa
nsehcrhk

Timeline for d4mgha2:

• d4mgha2 first appeared in SCOPe 2.03
  
• d4mgha2 appears in SCOPe 2.07