Lineage for d4mgha1 (4mgh A:1-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009677Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009678Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 3009696Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein)
    duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer
  6. 3009697Protein FGAM synthase PurL, PurS-like domain [111003] (3 species)
  7. 3009703Species Salmonella typhimurium [TaxId:99287] [229686] (1 PDB entry)
  8. 3009704Domain d4mgha1: 4mgh A:1-152 [229687]
    Other proteins in same PDB: d4mgha2, d4mgha3, d4mgha4, d4mgha5, d4mgha6, d4mgha7, d4mgha8
    automated match to d3ujna1
    complexed with act, adp, mg, mn, so4, xe

Details for d4mgha1

PDB Entry: 4mgh (more details), 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mgha1 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 99287]}
mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq
ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt
aeqwrqvaaelhdrmmetvfssltdaeklfih

SCOPe Domain Coordinates for d4mgha1:

Click to download the PDB-style file with coordinates for d4mgha1.
(The format of our PDB-style files is described here.)

Timeline for d4mgha1: