![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.284.1: PurS-like [82697] (3 families) ![]() segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
![]() | Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein) duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer |
![]() | Protein FGAM synthase PurL, PurS-like domain [111003] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:99287] [229686] (1 PDB entry) |
![]() | Domain d4mgha1: 4mgh A:1-152 [229687] Other proteins in same PDB: d4mgha2, d4mgha3, d4mgha4, d4mgha5, d4mgha6, d4mgha7, d4mgha8 automated match to d3ujna1 complexed with act, adp, mg, mn, so4, xe |
PDB Entry: 4mgh (more details), 2.65 Å
SCOPe Domain Sequences for d4mgha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mgha1 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 99287]} mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt aeqwrqvaaelhdrmmetvfssltdaeklfih
Timeline for d4mgha1: