SCOPe 2.08: Domain d4mgha7: 4mgh A:1034-1295

Lineage for d4mgha7 (4mgh A:1034-1295)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein FGAM synthase PurL, amidotransferase domain [110484] (3 species)

7. Species Salmonella typhimurium [TaxId:99287] [229696] (1 PDB entry)

8. Domain d4mgha7: 4mgh A:1034-1295 [229697]
   Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha4, d4mgha5, d4mgha6, d4mgha8
   automated match to d3ujna7
   complexed with act, adp, mg, mn, so4, xe

Details for d4mgha7

PDB Entry: 4mgh, 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha7:

Sequence; same for both SEQRES and ATOM records:

>d4mgha7 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 99287]}
iatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvacgg
fsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgsel
wprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaale
skglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvanswh
penwgedspwmrifrnarkqlg

Timeline for d4mgha7:

• d4mgha7 first appeared in SCOPe 2.03
  
• d4mgha7 appears in SCOPe 2.07