Lineage for d4mgha5 (4mgh A:617-816)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960239Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2960258Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)
  7. 2960267Species Salmonella typhimurium [TaxId:99287] [229690] (1 PDB entry)
  8. 2960269Domain d4mgha5: 4mgh A:617-816 [229694]
    Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha4, d4mgha6, d4mgha7, d4mgha8
    automated match to d3ujna5
    complexed with act, adp, mg, mn, so4, xe

Details for d4mgha5

PDB Entry: 4mgh (more details), 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mgha5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 99287]}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts
plslvisafarvedvrhtlt

SCOPe Domain Coordinates for d4mgha5:

Click to download the PDB-style file with coordinates for d4mgha5.
(The format of our PDB-style files is described here.)

Timeline for d4mgha5: