SCOPe 2.08: Domain d4mgha6: 4mgh A:817-1033

Lineage for d4mgha6 (4mgh A:817-1033)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains, C-terminal domain [419051] (3 species)

7. Species Salmonella typhimurium [TaxId:99287] [419542] (1 PDB entry)

8. Domain d4mgha6: 4mgh A:817-1033 [229695]
   Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha4, d4mgha5, d4mgha7, d4mgha8
   automated match to d3ujna6
   complexed with act, adp, mg, mn, so4, xe
   has additional insertions and/or extensions that are not grouped together

Details for d4mgha6

PDB Entry: 4mgh, 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha6:

Sequence; same for both SEQRES and ATOM records:

>d4mgha6 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains, C-terminal domain {Salmonella typhimurium [TaxId: 99287]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy

Timeline for d4mgha6:

• d4mgha6 first appeared in SCOPe 2.03
  
• d4mgha6 appears in SCOPe 2.07