| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein automated matches [190118] (16 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries) |
| Domain d3v61a_: 3v61 A: [227346] Other proteins in same PDB: d3v61b1, d3v61b2 automated match to d3v62d_ protein/DNA complex; complexed with ba, neq |
PDB Entry: 3v61 (more details), 2.8 Å
SCOPe Domain Sequences for d3v61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v61a_ d.15.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
thinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedl
dmedndiieahreqigg
Timeline for d3v61a_: