SCOPe 2.08: Domain d3v61b1: 3v61 B:1-126

Lineage for d3v61b1 (3v61 B:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein automated matches [227006] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries)

8. Domain d3v61b1: 3v61 B:1-126 [233829]
   Other proteins in same PDB: d3v61a_
   automated match to d1plqa1
   protein/DNA complex; complexed with ba, neq

Details for d3v61b1

PDB Entry: 3v61, 2.8 Å

PDB Description: structure of s. cerevisiae pcna conjugated to sumo on lysine 164

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3v61b1:

Sequence; same for both SEQRES and ATOM records:

>d3v61b1 d.131.1.2 (B:1-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

Timeline for d3v61b1:

• d3v61b1 first appeared in SCOPe 2.03
  
• d3v61b1 appears in SCOPe 2.07