| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein automated matches [190118] (16 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries) |
| Domain d3v62d_: 3v62 D: [193752] Other proteins in same PDB: d3v62b1, d3v62b2, d3v62e1, d3v62e2 automated match to d1euvb_ protein/DNA complex; complexed with neq, so4 |
PDB Entry: 3v62 (more details), 2.9 Å
SCOPe Domain Sequences for d3v62d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v62d_ d.15.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahreqigg
Timeline for d3v62d_: