Lineage for d3v61a_ (3v61 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539538Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)
  8. 2539545Domain d3v61a_: 3v61 A: [227346]
    Other proteins in same PDB: d3v61b1, d3v61b2
    automated match to d3v62d_
    protein/DNA complex; complexed with ba, neq

Details for d3v61a_

PDB Entry: 3v61 (more details), 2.8 Å

PDB Description: structure of s. cerevisiae pcna conjugated to sumo on lysine 164
PDB Compounds: (A:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d3v61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v61a_ d.15.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
thinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedl
dmedndiieahreqigg

SCOPe Domain Coordinates for d3v61a_:

Click to download the PDB-style file with coordinates for d3v61a_.
(The format of our PDB-style files is described here.)

Timeline for d3v61a_: