SCOPe 2.08: Domain d4h3ea1: 4h3e A:20-119

Lineage for d4h3ea1 (4h3e A:20-119)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226482] (2 PDB entries)

8. Domain d4h3ea1: 4h3e A:20-119 [222369]
   Other proteins in same PDB: d4h3ea2, d4h3eb2
   automated match to d1jr9a1
   complexed with fe2

Details for d4h3ea1

PDB Entry: 4h3e, 2.25 Å

PDB Description: crystal structure of a putative iron superoxide dismutase from trypanosoma cruzi bound to iron

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4h3ea1:

Sequence; same for both SEQRES and ATOM records:

>d4h3ea1 a.2.11.0 (A:20-119) automated matches {Trypanosoma cruzi [TaxId: 353153]}
yatlpdllkpsgapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagtty
dgksieeiilavandaekkglfnqaaqhfnhtfyfrcitp

Timeline for d4h3ea1:

• d4h3ea1 first appeared in SCOPe 2.03
  
• d4h3ea1 appears in SCOPe 2.07