![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
![]() | Species Bacillus halodenitrificans [TaxId:1482] [74665] (1 PDB entry) |
![]() | Domain d1jr9a1: 1jr9 A:2-91 [71822] Other proteins in same PDB: d1jr9a2 complexed with mn, zn |
PDB Entry: 1jr9 (more details), 2.8 Å
SCOPe Domain Sequences for d1jr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} kfelpelpyaydaleptidketmnihhtkhhntyvtklngaleghedlknkslndlisnl davpenirtavrnnggghanhslfwklmsp
Timeline for d1jr9a1: