Lineage for d4h3ea1 (4h3e A:20-119)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303798Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303799Protein automated matches [226859] (38 species)
    not a true protein
  7. 2304062Species Trypanosoma cruzi [TaxId:353153] [226482] (2 PDB entries)
  8. 2304065Domain d4h3ea1: 4h3e A:20-119 [222369]
    Other proteins in same PDB: d4h3ea2, d4h3eb2
    automated match to d1jr9a1
    complexed with fe2

Details for d4h3ea1

PDB Entry: 4h3e (more details), 2.25 Å

PDB Description: crystal structure of a putative iron superoxide dismutase from trypanosoma cruzi bound to iron
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4h3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h3ea1 a.2.11.0 (A:20-119) automated matches {Trypanosoma cruzi [TaxId: 353153]}
yatlpdllkpsgapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagtty
dgksieeiilavandaekkglfnqaaqhfnhtfyfrcitp

SCOPe Domain Coordinates for d4h3ea1:

Click to download the PDB-style file with coordinates for d4h3ea1.
(The format of our PDB-style files is described here.)

Timeline for d4h3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h3ea2