![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (26 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:353153] [226482] (2 PDB entries) |
![]() | Domain d4h3ea1: 4h3e A:20-119 [222369] Other proteins in same PDB: d4h3ea2, d4h3eb2 automated match to d1jr9a1 complexed with fe2 |
PDB Entry: 4h3e (more details), 2.25 Å
SCOPe Domain Sequences for d4h3ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h3ea1 a.2.11.0 (A:20-119) automated matches {Trypanosoma cruzi [TaxId: 353153]} yatlpdllkpsgapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagtty dgksieeiilavandaekkglfnqaaqhfnhtfyfrcitp
Timeline for d4h3ea1: