SCOPe 2.08: Domain d4h3ea2: 4h3e A:120-233

Lineage for d4h3ea2 (4h3e A:120-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226483] (2 PDB entries)

8. Domain d4h3ea2: 4h3e A:120-233 [222370]
   Other proteins in same PDB: d4h3ea1, d4h3eb1
   automated match to d1jr9a2
   complexed with fe2

Details for d4h3ea2

PDB Entry: 4h3e, 2.25 Å

PDB Description: crystal structure of a putative iron superoxide dismutase from trypanosoma cruzi bound to iron

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4h3ea2:

Sequence; same for both SEQRES and ATOM records:

>d4h3ea2 d.44.1.0 (A:120-233) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ngkampksfesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsna
gcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqaik

Timeline for d4h3ea2:

• d4h3ea2 first appeared in SCOPe 2.03
  
• d4h3ea2 appears in SCOPe 2.07