SCOPe 2.08: Domain d4gv7d1: 4gv7 D:663-796

Lineage for d4gv7d1 (4gv7 D:663-796)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)

8. Domain d4gv7d1: 4gv7 D:663-796 [222202]
   Other proteins in same PDB: d4gv7a2, d4gv7b2, d4gv7c2, d4gv7d2
   automated match to d1gs0a1
   complexed with mew

Details for d4gv7d1

PDB Entry: 4gv7, 2.89 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor me0328

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4gv7d1:

Sequence; same for both SEQRES and ATOM records:

>d4gv7d1 a.41.1.0 (D:663-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek

Timeline for d4gv7d1:

• d4gv7d1 first appeared in SCOPe 2.03
  
• d4gv7d1 appears in SCOPe 2.07