Lineage for d1gs0a1 (1gs0 A:207-340)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712206Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 2712207Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 2712227Species Mouse (Mus musculus) [TaxId:10090] [81765] (1 PDB entry)
  8. 2712228Domain d1gs0a1: 1gs0 A:207-340 [76323]
    Other proteins in same PDB: d1gs0a2, d1gs0b2

Details for d1gs0a1

PDB Entry: 1gs0 (more details), 2.8 Å

PDB Description: crystal structure of the catalytic fragment of murine poly (adp-ribose) polymerase-2
PDB Compounds: (A:) poly (ADP-ribose) polymerase-2

SCOPe Domain Sequences for d1gs0a1:

Sequence, based on SEQRES records: (download)

>d1gs0a1 a.41.1.1 (A:207-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus) [TaxId: 10090]}
esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkse
rqglehpldqhyrn

Sequence, based on observed residues (ATOM records): (download)

>d1gs0a1 a.41.1.1 (A:207-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus) [TaxId: 10090]}
esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkeh
pldqhyrn

SCOPe Domain Coordinates for d1gs0a1:

Click to download the PDB-style file with coordinates for d1gs0a1.
(The format of our PDB-style files is described here.)

Timeline for d1gs0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gs0a2