| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
| Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
| Protein automated matches [226964] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries) |
| Domain d4gv7b1: 4gv7 B:663-796 [222198] Other proteins in same PDB: d4gv7a2, d4gv7b2, d4gv7c2, d4gv7d2 automated match to d1gs0a1 complexed with mew |
PDB Entry: 4gv7 (more details), 2.89 Å
SCOPe Domain Sequences for d4gv7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gv7b1 a.41.1.0 (B:663-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek
Timeline for d4gv7b1: