Lineage for d4gv7d2 (4gv7 D:797-1010)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000809Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)
  8. 3000892Domain d4gv7d2: 4gv7 D:797-1010 [222203]
    Other proteins in same PDB: d4gv7a1, d4gv7b1, d4gv7c1, d4gv7d1
    automated match to d1gs0a2
    complexed with mew

Details for d4gv7d2

PDB Entry: 4gv7 (more details), 2.89 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor me0328
PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4gv7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gv7d2 d.166.1.0 (D:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4gv7d2:

Click to download the PDB-style file with coordinates for d4gv7d2.
(The format of our PDB-style files is described here.)

Timeline for d4gv7d2: