Lineage for d1suh__ (1suh -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.6: Cadherin [49313] (1 family) 
Family b.1.6.1: Cadherin [49314] (2 proteins) 
Protein E-cadherin (epithelial) [49317] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49318] (3 PDB entries) 
Domain d1suh__: 1suh - [22206]
Details for d1suh__
PDB Entry: 1suh (more details)
PDB Description: amino-terminal domain of epithelial cadherin in the calcium bound state, nmr, 20 structures
SCOP Domain Sequences for d1suh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suh__ b.1.6.1 (-) E-cadherin (epithelial) {Mouse (Mus musculus)}
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn
SCOP Domain Coordinates for d1suh__:
Click to download the PDB-style file with coordinates for d1suh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1suh__:
- d1suh__ appears in SCOP 1.57
- d1suh__ appears in the current release, SCOPe 2.08, called d1suha_
View in 3D