Lineage for d1suh__ (1suh -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55041Superfamily b.1.6: Cadherin [49313] (1 family) (S)
  5. 55042Family b.1.6.1: Cadherin [49314] (2 proteins)
  6. 55043Protein E-cadherin (epithelial) [49317] (1 species)
  7. 55044Species Mouse (Mus musculus) [TaxId:10090] [49318] (3 PDB entries)
  8. 55053Domain d1suh__: 1suh - [22206]

Details for d1suh__

PDB Entry: 1suh (more details)

PDB Description: amino-terminal domain of epithelial cadherin in the calcium bound state, nmr, 20 structures

SCOP Domain Sequences for d1suh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suh__ b.1.6.1 (-) E-cadherin (epithelial) {Mouse (Mus musculus)}
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn

SCOP Domain Coordinates for d1suh__:

Click to download the PDB-style file with coordinates for d1suh__.
(The format of our PDB-style files is described here.)

Timeline for d1suh__: