![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.1: Cadherin [49314] (4 proteins) |
![]() | Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries) |
![]() | Domain d1suha_: 1suh A: [22206] domain 1 |
PDB Entry: 1suh (more details)
SCOPe Domain Sequences for d1suha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suha_ b.1.6.1 (A:) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn
Timeline for d1suha_: