Lineage for d4e41f1 (4e41 F:3-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938265Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
  8. 2938272Domain d4e41f1: 4e41 F:3-81 [220256]
    Other proteins in same PDB: d4e41a2, d4e41b1, d4e41b2, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f2, d4e41g1, d4e41g2, d4e41i1, d4e41i2, d4e41j1, d4e41j2
    automated match to d1jwua2
    complexed with na; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d4e41f1

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (F:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4e41f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e41f1 d.19.1.1 (F:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d4e41f1:

Click to download the PDB-style file with coordinates for d4e41f1.
(The format of our PDB-style files is described here.)

Timeline for d4e41f1: