| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries) |
| Domain d4e41g1: 4e41 G:4-92 [220258] Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b2, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f1, d4e41f2, d4e41g2, d4e41i1, d4e41i2, d4e41j1, d4e41j2 automated match to d1klub2 complexed with na; mutant fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 4e41 (more details), 2.6 Å
SCOPe Domain Sequences for d4e41g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e41g1 d.19.1.1 (G:4-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq
Timeline for d4e41g1: