Lineage for d4e41i1 (4e41 I:1-110)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356186Domain d4e41i1: 4e41 I:1-110 [220260]
    Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d2, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i2, d4e41j2
    automated match to d2f54d1
    complexed with na; mutant

Details for d4e41i1

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (I:) T cell receptor G4 alpha chain

SCOPe Domain Sequences for d4e41i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e41i1 b.1.1.0 (I:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d4e41i1:

Click to download the PDB-style file with coordinates for d4e41i1.
(The format of our PDB-style files is described here.)

Timeline for d4e41i1: