| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4e41j2: 4e41 J:111-238 [220263] Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d1, d4e41e1, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i1, d4e41j1 automated match to d2esve2 complexed with na; mutant |
PDB Entry: 4e41 (more details), 2.6 Å
SCOPe Domain Sequences for d4e41j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e41j2 b.1.1.2 (J:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra
Timeline for d4e41j2: