Lineage for d1f13a1 (1f13 A:5-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765693Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2765694Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2765695Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (9 PDB entries)
    Coagulation factor XIII
  8. 2765696Domain d1f13a1: 1f13 A:5-190 [21877]
    Other proteins in same PDB: d1f13a2, d1f13a3, d1f13a4, d1f13b2, d1f13b3, d1f13b4

Details for d1f13a1

PDB Entry: 1f13 (more details), 2.1 Å

PDB Description: recombinant human cellular coagulation factor xiii
PDB Compounds: (A:) cellular coagulation factor xiii zymogen

SCOPe Domain Sequences for d1f13a1:

Sequence, based on SEQRES records: (download)

>d1f13a1 b.1.18.9 (A:5-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
rtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdh
htdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivse
lqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilf
npwced

Sequence, based on observed residues (ATOM records): (download)

>d1f13a1 b.1.18.9 (A:5-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
rtafggrravppnnsnaaeddlptvelqgvvpvnlqeflnvtsvhlfkerwdtnkvdhht
dkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselq
sgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnp
wced

SCOPe Domain Coordinates for d1f13a1:

Click to download the PDB-style file with coordinates for d1f13a1.
(The format of our PDB-style files is described here.)

Timeline for d1f13a1: