Lineage for d1f13a3 (1f13 A:628-728)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763296Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2763297Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2763298Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2763299Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries)
    Coagulation factor XIII,
  8. 2763301Domain d1f13a3: 1f13 A:628-728 [22164]
    Other proteins in same PDB: d1f13a1, d1f13a4, d1f13b1, d1f13b4

Details for d1f13a3

PDB Entry: 1f13 (more details), 2.1 Å

PDB Description: recombinant human cellular coagulation factor xiii
PDB Compounds: (A:) cellular coagulation factor xiii zymogen

SCOPe Domain Sequences for d1f13a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f13a3 b.1.5.1 (A:628-728) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrr

SCOPe Domain Coordinates for d1f13a3:

Click to download the PDB-style file with coordinates for d1f13a3.
(The format of our PDB-style files is described here.)

Timeline for d1f13a3: