Lineage for d1f13a3 (1f13 A:628-728)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10036Superfamily b.1.5: Transglutaminase [49309] (1 family) (S)
  5. 10037Family b.1.5.1: Transglutaminase [49310] (1 protein)
  6. 10038Protein Coagulation factor XIII, two C-terminal domains [49311] (1 species)
  7. 10039Species Human (Homo sapiens), blood [TaxId:9606] [49312] (7 PDB entries)
  8. 10041Domain d1f13a3: 1f13 A:628-728 [22164]
    Other proteins in same PDB: d1f13a1, d1f13a4, d1f13b1, d1f13b4

Details for d1f13a3

PDB Entry: 1f13 (more details), 2.1 Å

PDB Description: recombinant human cellular coagulation factor xiii
PDB Compounds: (A:)

SCOP Domain Sequences for d1f13a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f13a3 b.1.5.1 (A:628-728) Coagulation factor XIII, two C-terminal domains {Human (Homo sapiens), blood}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrr

SCOP Domain Coordinates for d1f13a3:

Click to download the PDB-style file with coordinates for d1f13a3.
(The format of our PDB-style files is described here.)

Timeline for d1f13a3: