Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
Protein CelD cellulase, N-terminal domain [49231] (1 species) precedes the catalytic alpha6/alpha6 domain |
Species Clostridium thermocellum [TaxId:1515] [49232] (1 PDB entry) |
Domain d1clc_2: 1clc 35-134 [21872] Other proteins in same PDB: d1clc_1 complexed with ca, zn |
PDB Entry: 1clc (more details), 1.9 Å
SCOP Domain Sequences for d1clc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clc_2 b.1.18.2 (35-134) CelD cellulase, N-terminal domain {Clostridium thermocellum} ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat smfdndtketvyiadfssvneegtyylavpgvgksvnfki
Timeline for d1clc_2: