SCOP 1.63: Domain d1clc_2: 1clc 35-134

Lineage for d1clc_2 (1clc 35-134)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location

6. Protein CelD cellulase, N-terminal domain [49231] (1 species)
   precedes the catalytic alpha6/alpha6 domain

7. Species Clostridium thermocellum [TaxId:1515] [49232] (1 PDB entry)

8. Domain d1clc_2: 1clc 35-134 [21872]
   Other proteins in same PDB: d1clc_1
   complexed with ca, zn

Details for d1clc_2

PDB Entry: 1clc, 1.9 Å

PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution

SCOP Domain Sequences for d1clc_2:

Sequence; same for both SEQRES and ATOM records:

>d1clc_2 b.1.18.2 (35-134) CelD cellulase, N-terminal domain {Clostridium thermocellum}
ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat
smfdndtketvyiadfssvneegtyylavpgvgksvnfki

Timeline for d1clc_2:

• d1clc_2 first appeared (with stable ids) in SCOP 1.55
  
• d1clc_2 appears in SCOP 1.61
  
• d1clc_2 appears in SCOP 1.65
  
• d1clc_2 appears in the current release, SCOPe 2.08, called d1clca2